RegulonDB RegulonDB 10.9: Amino acid Sequence
putative oxidoreductase with FAD/NAD(P)-binding domain Amino Acid Sequence


Size: 423

Fasta

 

>putative oxidoreductase with FAD/NAD(P)-binding domain E. coli K12. Version NC_000913.3 GI:556503834
MEDDCDIIIIGAGIAGTACALRCARAGLSVLLLERAEIPGSKNLSGGRLYTHALAELLPQ
FHLTAPLERRITHESLSLLTPDGVTTFSSLQPGGESWSVLRARFDPWLVAEAEKEGVECI
PGATVDALYEENGRVCGVICGDDILRARYVVLAEGANSVLAERHGLVTRPAGEAMALGIK
EVLSLETSAIEERFHLENNEGAALLFSGRICDDLPGGAFLYTNQQTLSLGIVCPLSSLTQ
SRVPASELLTRFKAHPAVRPLIKNTESLEYGAHLVPEGGLHSMPVQYAGNGWLLVGDALR
SCVNTGISVRGMDMALTGAQAAAQTLISACQHREPQNLFPLYHHNVERSLLWDVLQRYQH
VPALLQRPGWYRTWPALMQDISRDLWDQGDKPVPPLRQLFWHHLRRHGLWHLAGDVIRSL
RCL
              
                            

Download fasta file
RegulonDB