RegulonDB RegulonDB 10.9: Amino acid Sequence
putative 7-carboxy-7-deazaguanine synthase QueE Amino Acid Sequence


Size: 223

Fasta

 

>putative 7-carboxy-7-deazaguanine synthase QueE E. coli K12. Version NC_000913.3 GI:556503834
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWEKLEDREVSLFSILAK
TKESDKWGAASSEDLLAVIGRQGYTARHVVITGGEPCIHDLLPLTDLLEKNGFSCQIETS
GTHEVRCTPNTWVTVSPKLNMRGGYEVLSQALERANEIKHPVGRVRDIEALDELLATLTD
DKPRVIALQPISQKDDATRLCIETCIARNWRLSMQTHKYLNIA
              
                            

Download fasta file
RegulonDB