RegulonDB RegulonDB 10.9: Amino acid Sequence
putative NADP(H)-dependent aldo-keto reductase Tas Amino Acid Sequence


Size: 346

Fasta

 

>putative NADP(H)-dependent aldo-keto reductase Tas E. coli K12. Version NC_000913.3 GI:556503834
MQYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPE
TQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKR
LQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSN
ETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGT
LTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHGLDPAQMALAFVRRQP
FVASTLLGATTMDQLKTNIESLHLELSEDVLAEIEAVHQVYTYPAP
              
                            

Download fasta file
RegulonDB