RegulonDB RegulonDB 10.9: Amino acid Sequence
protein YqeK Amino Acid Sequence


Size: 141

Fasta

 

>protein YqeK E. coli K12. Version NC_000913.3 GI:556503834
MDIEFSQIHEMVYMHDIVNSDSKKKPRIPLKKFLNAENVLTQTTSWTLNSRYVNVNSVNK
VNVKSKVKNSYISRSVNDEFSLTDDEINSFKETLVLSSIDSLSKLVLNNPLSVLFTSTVR
RNNNRAKMNVEFDSWICTRCC
              
                            

Download fasta file
RegulonDB