RegulonDB RegulonDB 10.10: Amino acid Sequence
protein YgeF Amino Acid Sequence


Size: 162

Fasta

 

>protein YgeF E. coli K12. Version NC_000913.3 GI:556503834
MKPRNINNSLPLQPLVPDQENKNKKNEEKSVNPVKITMGSGLNYIEQESLGGKYLTHDLS
IKIADISEEIIQQAILSAMSIYKFSITDDLMSMAVNELIKLTKIENNVDLNKFTTICTDV
LSPRVTRHNKEKNKRHSTLLKNPLFNFH*KNGN*YYESRSYT
              
                            

Download fasta file
RegulonDB