RegulonDB RegulonDB 10.9: Amino acid Sequence
protein YgeI Amino Acid Sequence


Size: 72

Fasta

 

>protein YgeI E. coli K12. Version NC_000913.3 GI:556503834
MTNPIGINNLSQSSNIANATGDEVVSLDKHINTSATDTDQIQAFIVSTWMAPFQNDMYSE
DNPISPYYKIEW
              
                            

Download fasta file
RegulonDB