RegulonDB RegulonDB 10.9: Amino acid Sequence
putative uncharacterized protein YgeO Amino Acid Sequence


Size: 132

Fasta

 

>putative uncharacterized protein YgeO E. coli K12. Version NC_000913.3 GI:556503834
MNNWNLLPLICLLSGCHFYRERFAERGFFYKVPDVLRDYLSAIPLEINEKARYKPGIANY
HNIITCGFSTLLPYIRQQPLAMQQRFNLLFPDFVDHIQSPLPLASTLLERITFYAKKNRD
ELDKISCKWCCD
              
                            

Download fasta file
RegulonDB