RegulonDB RegulonDB 10.10: Amino acid Sequence
DUF167 domain-containing protein YggU Amino Acid Sequence


Size: 96

Fasta

 

>DUF167 domain-containing protein YggU E. coli K12. Version NC_000913.3 GI:556503834
MNAVTVNDDGLVLRLYIQPKASRDSIVGLHGDEVKVAITAPPVDGQANSHLVKFLGKQFR
VAKSQVVIEKGELGRHKQIKIINPQQIPPEIAALIN
              
                            

Download fasta file
RegulonDB