RegulonDB RegulonDB 10.10: Amino acid Sequence
membrane-bound lytic murein transglycosylase C Amino Acid Sequence


Size: 359

Fasta

 

>membrane-bound lytic murein transglycosylase C E. coli K12. Version NC_000913.3 GI:556503834
MKKYLALALIAPLLISCSTTKKGDTYNEAWVKDTNGFDILMGQFAHNIENIWGFKEVVIA
GPKDYVKYTDQYQTRSHINFDDGTITIETIAGTEPAAHLRRAIIKTLLMGDDPSSVDLYS
DVDDITISKEPFLYGQVVDNTGQPIRWEGRASNFADYLLKNRLKSRSNGLRIIYSVTINM
VPNHLDKRAHKYLGMVRQASRKYGVDESLILAIMQTESSFNPYAVSRSDALGLMQVVQHT
AGKDVFRSQGKSGTPSRSFLFDPASNIDTGTAYLAMLNNVYLGGIDNPTSRRYAVITAYN
GGAGSVLRVFSNDKIQAANIINTMTPGDVYQTLTTRHPSAESRRYLYKVNTAQKSYRRR
              
                            

Download fasta file
RegulonDB