RegulonDB RegulonDB 10.9: Amino acid Sequence
glycolate dehydrogenase, putative FAD-linked subunit Amino Acid Sequence


Size: 499

Fasta

 

>glycolate dehydrogenase, putative FAD-linked subunit E. coli K12. Version NC_000913.3 GI:556503834
MSILYEERLDGALPDVDRTSVLMALREHVPGLEILHTDEEIIPYECDGLSAYRTRPLLVV
LPKQMEQVTAILAVCHRLRVPVVTRGAGTGLSGGALPLEKGVLLVMARFKEILDINPVGR
RARVQPGVRNLAISQAVAPHNLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLL
KIEVQTLDGEALTLGSDALDSPGFDLLALFTGSEGMLGVTTEVTVKLLPKPPVARVLLAS
FDSVEKAGLAVGDIIANGIIPGGLEMMDNLSIRAAEDFIHAGYPVDAEAILLCELDGVES
DVQEDCERVNDILLKAGATDVRLAQDEAERVRFWAGRKNAFPAVGRISPDYYCMDGTIPR
RALPGVLEGIARLSQQYDLRVANVFHAGDGNMHPLILFDANEPGEFARAEELGGKILELC
VEVGGSISGEHGIGREKINQMCAQFNSDEITTFHAVKAAFDPDGLLNPGKNIPTLHRCAE
FGAMHVHHGHLPFPELERF
              
                            

Download fasta file
RegulonDB