RegulonDB RegulonDB 10.10: Amino acid Sequence
DNA-binding transcriptional activator YqhC Amino Acid Sequence


Size: 318

Fasta

 

>DNA-binding transcriptional activator YqhC E. coli K12. Version NC_000913.3 GI:556503834
MLQNCAQSNCRIIPKKLRDMKREEICRLLADKVNKLKNKENSLSGLLPDVRLLYGETPFA
RTPVMYEPGIIILFSGHKIGYINERVFRYDANEYLLLTVPLPFECETYATSEVPLAGLRL
NVDILQLQELLMDIGEDEHFQPSMAASGINSATLSEEILCAAERLLDVMERPLDARILGK
QIIREILYYVLTGPCGGALLALVSRQTHFSLISRVLKRIENKYTENLSVEQLAAEANMSV
SAFHHNFKSVTSTSPLQYLKNYRLHKARMMIIHDGMKASAAAMRVGYESASQFSREFKRY
FGVTPGEDAARMRAMQGN
              
                            

Download fasta file
RegulonDB