RegulonDB RegulonDB 10.10: Amino acid Sequence
esterase YqiA Amino Acid Sequence


Size: 193

Fasta

 

>esterase YqiA E. coli K12. Version NC_000913.3 GI:556503834
MSTLLYLHGFNSSPRSAKASLLKNWLAEHHPDVEMIIPQLPPYPSDAAELLESIVLEHGG
DSLGIVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLTDYLGQNENPYTGQQYVLESR
HIYDLKVMQIDPLEAPDLIWLLQQTGDEVLDYRQAVAYYASCRQTVIEGGNHAFTGFEDY
FNPIVDFLGLHHL
              
                            

Download fasta file
RegulonDB