RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1249 domain-containing protein YqiB Amino Acid Sequence


Size: 140

Fasta

 

>DUF1249 domain-containing protein YqiB E. coli K12. Version NC_000913.3 GI:556503834
MKRYTPDFPEMMRLCEMNFSQLRRLLPRNDAPGETVSYQVANAQYRLTIVESTRYTTLVT
IEQTAPAISYWSLPSMTVRLYHDAMVAEVCSSQQIFRFKARYDYPNKKLHQRDEKHQINQ
FLADWLRYCLAHGAMAIPVY
              
                            

Download fasta file
RegulonDB