RegulonDB RegulonDB 11.1: Amino acid Sequence
DUF1090 domain-containing protein YqjC Amino Acid Sequence


Size: 122

Fasta

 

>DUF1090 domain-containing protein YqjC E. coli K12. Version NC_000913.3 GI:556503834
MKYRIALAVSLFALSAGSYATTLCQEKEQNILKEISYAEKHQNQNRIDGLNKALSEVRAN
CSDSQLRADHQKKIAKQKDEVAERQQDLAEAKQKGDADKIAKRERKLAEAQEELKKLEAR
DY
              
                            

Download fasta file
RegulonDB