RegulonDB RegulonDB 10.9: Amino acid Sequence
anaerobic ubiquinone biosynthesis accessory factor UbiT Amino Acid Sequence


Size: 174

Fasta

 

>SCP2 domain-containing protein YhbT E. coli K12. Version NC_000913.3 GI:556503834
MLDKLRSRIVHLGPSLLSVPVKLTPFALKRQVLEQVLSWQFRQALDDGELEFLEGRWLSI
HVRDIDLQWFTSVVNGKLVVSQNAQADVSFSADASDLLMIAARKQDPDTLFFQRRLVIEG
DTELGLYVKNLMDAIELEQMPKALRMMLLQLADFVEAGMKTAPETKQTSVGEPC
              
                            

Download fasta file
RegulonDB