RegulonDB RegulonDB 10.9: Amino acid Sequence
acid stress protein IbaG Amino Acid Sequence


Size: 84

Fasta

 

>acid stress protein IbaG E. coli K12. Version NC_000913.3 GI:556503834
MENNEIQSVLMNALSLQEVHVSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYIADN
RIHAVSIKAYTPAEWARDRKLNGF
              
                            

Download fasta file
RegulonDB