RegulonDB RegulonDB 10.9: Amino acid Sequence
3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC Amino Acid Sequence


Size: 188

Fasta

 

>3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC E. coli K12. Version NC_000913.3 GI:556503834
MSKAGASLATCYGPVSADVIAKAENIRLLILDVDGVLSDGLIYMGNNGEELKAFNVRDGY
GIRCALTSDIEVAIITGRKAKLVEDRCATLGITHLYQGQSNKLIAFSDLLEKLAIAPENV
AYVGDDLIDWPVMEKVGLSVAVADAHPLLIPRADYVTRIAGGRGAVREVCDLLLLAQGKL
DEAKGQSI
              
                            

Download fasta file
RegulonDB