RegulonDB RegulonDB 10.9: Amino acid Sequence
protein kinase-like domain-containing protein YrbL Amino Acid Sequence


Size: 210

Fasta

 

>protein kinase-like domain-containing protein YrbL E. coli K12. Version NC_000913.3 GI:556503834
MIRLSEQSPLGTGRHRKCYAHPEDAQRCIKIVYHRGDGGDKEIRRELKYYAHLGRRLKDW
SGIPRYHGTVETDCGTGYVYDVIADFDGKPSITLTEFAEQCRYEEDIAQLRQLLKQLKRY
LQDNRIVTMSLKPQNILCHRISESEVIPVVCDNIGESTLIPLATWSKWCCLRKQERLWKR
FIAQPALAIALQKDLQPRESKTLALTSREA
              
                            

Download fasta file
RegulonDB