RegulonDB RegulonDB 10.9: Amino acid Sequence
peptidoglycan glycosyltransferase MtgA Amino Acid Sequence


Size: 242

Fasta

 

>peptidoglycan glycosyltransferase MtgA E. coli K12. Version NC_000913.3 GI:556503834
MSKSRLTVFSFVRRFLLRLMVVLAVFWGGGIALFSVAPVPFSAVMVERQVSAWLHGNFRY
VAHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTIS
QQTAKNLFLWDGRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGVFGVEAAAQR
YFHKPASKLTRSEAALLAAVLPNPLRFKVSSPSGYVRSRQAWILRQMYQLGGEPFMQQHQ
LD
              
                            

Download fasta file
RegulonDB