RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF386 domain-containing protein YhcH Amino Acid Sequence


Size: 154

Fasta

 

>DUF386 domain-containing protein YhcH E. coli K12. Version NC_000913.3 GI:556503834
MMMGEVQSLPSAGLHPALQDALTLALAARPQEKAPGRYELQGDNIFMNVMTFNTQSPVEK
KAELHEQYIDIQLLLNGEERILFGMAGTARQCEEFHHEDDYQLCSTIDNEQAIILKPGMF
AVFMPGEPHKPGCVVGEPGEIKKVVVKVKADLMA
              
                            

Download fasta file
RegulonDB