RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF997 domain-containing protein YhdT Amino Acid Sequence


Size: 80

Fasta

 

>DUF997 domain-containing protein YhdT E. coli K12. Version NC_000913.3 GI:556503834
MDTRFVQAHKEARWALGLTLLYLAVWLVAAYLSGVAPGFTGFPRWFEMACILTPLLFIGL
CWAMVKFIYRDIPLEDDDAA
              
                            

Download fasta file
RegulonDB