RegulonDB RegulonDB 10.9: Amino acid Sequence
peptidyl-prolyl cis-trans isomerase FkpA Amino Acid Sequence


Size: 270

Fasta

 

>peptidyl-prolyl cis-trans isomerase FkpA E. coli K12. Version NC_000913.3 GI:556503834
MKSLFKVTLLATTMAVALHAPITFAAEAAKPATAADSKAAFKNDDQKSAYALGASLGRYM
ENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKD
AADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKE
FDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLV
FDVELLDVKPAPKADAKPEADAKAADSAKK
              
                            

Download fasta file
RegulonDB