RegulonDB RegulonDB 10.10: Amino acid Sequence
RNA 3'-terminal phosphate cyclase Amino Acid Sequence


Size: 338

Fasta

 

>RNA 3'-terminal phosphate cyclase E. coli K12. Version NC_000913.3 GI:556503834
MKRMIALDGAQGEGGGQILRSALSLSMITGQPFTITSIRAGRAKPGLLRQHLTAVKAATE
ICGATVEGAELGSQRLLFRPGTVRGGDYRFAIGSAGSCTLVLQTVLPALWFADGPSRVEV
SGGTDNPSAPPADFIRRVLEPLLAKIGIHQQTTLLRHGFYPAGGGVVATEVSPVASFNTL
QLGERGNIVQMRGEVLLAGVPRHVAEREIATLAGSFSLHEQNIHNLPRDQGPGNTVSLEV
ESENITERFFVVGEKRVSAEVVAAQLVKEVKRYLASTAAVGEYLADQLVLPMALAGAGEF
TVAHPSCHLLTNIAVVERFLPVRFSLIETDGVTRVSIE
              
                            

Download fasta file
RegulonDB