RegulonDB RegulonDB 10.9: Amino acid Sequence
IS150 conserved protein InsB Amino Acid Sequence


Size: 283

Fasta

 

>IS150 conserved protein InsB E. coli K12. Version NC_000913.3 GI:556503834
MKVLNELRQFYPLDELLRAAEIPRSTFYYHLKALSKPDKYADVKKRISEIYHENRGRYGY
RRVTLSLHREGKQINHKAVQRLMGTLSLKAAIKVKRYRSYRGEVGQTAPNVLQRDFKATR
PNEKWVTDVTEFAVNGRKLYLSPVIDLFNNEVISYSLSERPVMNMVENMLDQAFKKLNPH
EHPVLHSDQGWQYRMRRYQNILKEHGIKQSMSRKGNCLDNAVVECFFGTLKSECFYLDEF
SNISELKDAVTEYIEYYNSRRISLKLKGLTPIEYRNQTYMPRV
              
                            

Download fasta file
RegulonDB