RegulonDB RegulonDB 11.0: Amino acid Sequence
PspA family protein YjfJ Amino Acid Sequence


Size: 232

Fasta

 

>PspA family protein YjfJ E. coli K12. Version NC_000913.3 GI:556503834
MGILKSLFTLGKSFISQAEESIEETQGVRMLEQHIRDAKAELDKAGKSRVDLLARVKLSH
DKLKDLRERKASLEARALEALSKNVNPSLINEVAEEIARLENLITAEEQVLSNLEVSRDG
VEKAVTATAQRIAQFEQQMEVVKATEAMQRAQQAVTTSTVGASSSVSTAAESLKRLQTRQ
AERQARLDAAAQLEKVADGRDLDEKLAEAGIGGSNKSSAQDVLARLQRQQGE
              
                            

Download fasta file
RegulonDB