RegulonDB RegulonDB 11.0: Amino acid Sequence
DUF350 domain-containing inner membrane protein YjfL Amino Acid Sequence


Size: 132

Fasta

 

>DUF350 domain-containing inner membrane protein YjfL E. coli K12. Version NC_000913.3 GI:556503834
MHILDSLLAFSAYFFIGVAMVIIFLFIYSKITPHNEWQLIKNNNTAASLAFSGTLLGYVI
PLSSAAINAVSIPDYFAWGGIALVIQLLVFAGVRLYMPALSEKIINHNTAAGMFMGTAAL
AGGIFNAACMTW
              
                            

Download fasta file
RegulonDB