RegulonDB RegulonDB 10.10: Amino acid Sequence
DUF1471 domain-containing putative lipoprotein BsmA Amino Acid Sequence


Size: 109

Fasta

 

>DUF1471 domain-containing putative lipoprotein BsmA E. coli K12. Version NC_000913.3 GI:556503834
MVSRKRNSVIYRFASLLLVLMLSACSALQGTPQPAPPVTDHPQEIRRDQTQGLQRIGSVS
TMVRGSPDDALAEIKAKAVAAKADYYVVVMVDETIVTGQWYSQAILYRK
              
                            

Download fasta file
RegulonDB