RegulonDB RegulonDB 11.0: Amino acid Sequence
anti-adaptor protein IraD Amino Acid Sequence


Size: 130

Fasta

 

>anti-adaptor protein IraD, inhibitor of σS proteolysis E. coli K12. Version NC_000913.3 GI:556503834
MMRQSLQAVLPEISGNKTSSLRKSVCSDLLTLFNSPHSALPSLLVSGMPEWQVHNPSDKH
LQSWYCRQLRSALLFHEPRIAALQVNLKEAYCHTLAISLEIMLYHDDEPLTFDLVWDNGG
WRSATLENVS
              
                            

Download fasta file
RegulonDB