RegulonDB RegulonDB 11.0: Amino acid Sequence
uncharacterized protein YjiH Amino Acid Sequence


Size: 227

Fasta

 

>Gate family protein YjiH E. coli K12. Version NC_000913.3 GI:556503834
MTQQGDAVAGELATEKVGIKGYLAFFLTIIFFSGVFSGTDSWWRVFDFSVLNGSFGQLPG
ANGATTSFRGAGGAGAKDGFLFALELAPSVILSLGIISITDGLGGLRAAQQLMTPVLKPL
LGIPGICSLALIANLQNTDAAAGMTKELAQEGEITERDKVIFAAYQTSGSAIITNYFSSG
VAVFAFLGTSVIVPLAVILVFKFVGANILRVWLNFEERRNPTQGAQA
              
                            

Download fasta file
RegulonDB