RegulonDB RegulonDB 11.0: Amino acid Sequence
PF06977 family protein YjiK Amino Acid Sequence


Size: 286

Fasta

 

>uncharacterized protein YjiK E. coli K12. Version NC_000913.3 GI:556503834
MTKSISLSKRISIIVILFAIVAVCTFFVQSCARKSNHAASFQNYHATIDGKEIAGITNNI
SSLTWSAQSNTLFSTINKPAAIVEMTTNGDFIRTIPLDFVKDLETIEYIGDNQFVISDER
DYAIYVISLTPNSEVKILKKIKIPLQDSPTNCGFEGLAYSRQDHTFWFFKEKNPIEVYKV
NGLLSSNELHISKDEALQRQFTLDDVSGAEFNQQKNTLLVLSHESRALQEVTLVGEVIGE
MSLTKGSRGLSHNIKQAEGVAMDASGNIYIVSEPNRFYRFTPQSSH
              
                            

Download fasta file
RegulonDB