RegulonDB RegulonDB 11.0: Amino acid Sequence
putative dehydratase subunit Amino Acid Sequence


Size: 383

Fasta

 

>putative dehydratase subunit E. coli K12. Version NC_000913.3 GI:556503834
MSLVTDLPAIFDQFSEARQTGFLTVMDLKERGIPLVGTYCTFMPQEIPMAAGAVVVSLCS
TSDETIEEAEKDLPRNLCPLIKSSYGFGKTDKCPYFYFSDLVVGETTCDGKKKMYEYMAE
FKPVHVMQLPNSVKDDASRALWKAEMLRLQKTVEERFGHEISEDALRDAIALKNRERRAL
ANFYHLGQLNPPALSGSDILKVVYGATFRFDKEALINELDAMTARVRQQWEEGQRLDPRP
RILITGCPIGGAAEKVVRAIEENGGWVVGYENCTGAKATEQCVAETGDVYDALADKYLAI
GCSCVSPNDQRLKMLSQMVEEYQVDGVVDVILQACHTYAVESLAIKRHVRQQHNIPYIAI
ETDYSTSDVGQLSTRVAAFIEML
              
                            

Download fasta file
RegulonDB