RegulonDB RegulonDB 11.0: Amino acid Sequence
putative inactive recombination-promoting nuclease-like protein RpnD Amino Acid Sequence


Size: 306

Fasta

 

>truncated recombination-promoting nuclease-like protein RpnD E. coli K12. Version NC_000913.3 GI:556503834
MTNFTTSTPHDALFKTFLTHPDTARDFMEIHLPKDLRELCDLDSLKLESASFVDEKLRAL
HSDILWSVKTREGDGYIYVVIEHQSREDIHMAFRLMRYSMAVM*RHIEHDKRQPLPLVIP
MLFYHGSRSPYPWSLCWLDEFADPTTARKLYNAAFPLVDVTVVPDDEIVQHRRVALLELI
QKHIRQRDLMGLIDQLVVLLVTECANDSQITALLNYILLTGDEARFNEFISELTRRMPQH
RERIMTIAERIHNDGYIKGEQRILRLLLQNGADPEWIQKITGLSAEQMQALRQPLPERER
YSWLKS
              
                            

Download fasta file
RegulonDB