RegulonDB RegulonDB 11.0: Amino acid Sequence
fused putative DNA-binding transcriptional regulator/putative aminotransferase YjiR Amino Acid Sequence


Size: 470

Fasta

 

>fused putative DNA-binding transcriptional regulator/putative aminotransferase YjiR E. coli K12. Version NC_000913.3 GI:556503834
MTRYQHLATLLAERIEQGLYRHGEKLPSVRSLSQEHGVSISTVQQAYQTLETMKLITPQP
RSGYFVAQRKAQPPVPPMTRPVQRPVEITQWDQVLDMLEAHSDSSIVPLSKSTPDVEAPS
LKPLWRELSRVVQHNLQTVLGYDLLAGQRVLREQIARLMLDSGSVVTADDIIITSGCHNS
MSLALMAVCKPGDIVAVESPCYYGSMQMLRGMGVKVIEIPTDPETGISVEALELALEQWP
IKGIILVPNCNNPLGFIMPDARKRAVLSLAQRHDIVIFEDDVYGELATEYPRPRTIHSWD
IDGRVLLCSSFSKSIAPGLRVGWVAPGRYHDKLMHMKYAISSFNVPSTQMAAATFVLEGH
YHRHIRRMRQIYQRNLALYTCWIREYFPCEICITRPKGGFLLWIELPEQVDMVCVARQLC
RMKIQVAAGSIFSASGKYRNCLRINCALPLSETYREALKQIGEAVYRAME
              
                            

Download fasta file
RegulonDB