RegulonDB RegulonDB 11.0: Amino acid Sequence
DUF1127 domain-containing protein YjiS Amino Acid Sequence


Size: 54

Fasta

 

>DUF1127 domain-containing protein YjiS E. coli K12. Version NC_000913.3 GI:556503834
MEFHENRAKAPFIGLVQLWQAVRRWRRQMQTRRVLQQMSDERLKDIGLRREDVE
              
                            

Download fasta file
RegulonDB