RegulonDB RegulonDB 10.9: Amino acid Sequence
putative DNA-binding transcriptional regulator LgoR Amino Acid Sequence


Size: 304

Fasta

 

>putative DNA-binding transcriptional regulator LgoR E. coli K12. Version NC_000913.3 GI:556503834
MSRSQNLRHNVINQVIDDMARGHIPSPLPSQSALAEMYNISRTTVRHILSHLRECGVLTQ
VGNDYVIARKPDHDDGFACTTASMSEQNKVFEQAFFTMINQRQLRPGETFSELQLARAAG
VSPVVVREYLLKFGRYNLIHSEKRGQWSMKQFDQSYAEQLFELREMLETHSLQHFLNLPD
HDPRWLQAKTMLERHRLLRDNIGNSFRMFSQLDRDFHSLLLSAADNIFFDQSLEIISVIF
HFHYQWDESDLKQRNIIAVDEHMTILSALICRSDLDATLALRNHLNSAKQSMIRSINENT
RYAH
              
                            

Download fasta file
RegulonDB