RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2541 domain-containing protein YaaI Amino Acid Sequence


Size: 134

Fasta

 

>DUF2541 domain-containing protein YaaI E. coli K12. Version NC_000913.3 GI:556503834
MKSVFTISASLAISLMLCCTAQANDHKLLGAIAMPRNETNDLALKLPVCRIVKRIQLSAD
HGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDNDNKRCVSKITFSGHTV
NSSDMATLKIIGDD
              
                            

Download fasta file
RegulonDB