RegulonDB RegulonDB 10.9: Amino acid Sequence
glyceraldehyde-3-phosphate dehydrogenase Amino Acid Sequence


Size: 332

Fasta

 

>glyceraldehyde-3-phosphate dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MSKVGINGFGRIGRLVLGRLLEVKSNIDVVAINDLTSP*ILAYLLKHDSNYGPFPWSVDF
TEDSLIVDGKSIAVYAEKEAKNIPWKAKGAEIIVECTGFYTSAEKSQAHLDAGAKKVLIS
APAGEMKTIVYNVNDDTLDGNDTIVSVASCTTNCLAPMAKALHDSFGIEVGTMTTIHAYT
GTQSLVDGPRGKDLRASRAAAENIIPHTTGAAKAIGLVIPELSGKLKGHAQRVPVKTGSV
TELVSILGKK*LPKR*ITHLNKQPPITSHLVIPMKK*SLPISLAAISVRCLMPRKRKLPP
WAIYNW*KRSPGTITNMASSHSLFAPSKNSLN
              
                            

Download fasta file
RegulonDB