RegulonDB RegulonDB 10.9: Amino acid Sequence
3-carboxyethylcatechol 2,3-dioxygenase Amino Acid Sequence


Size: 314

Fasta

 

>3-carboxyethylcatechol 2,3-dioxygenase E. coli K12. Version NC_000913.3 GI:556503834
MHAYLHCLSHSPLVGYVDPAQEVLDEVNGVIASARERIAAFSPELVVLFAPDHYNGFFYD
VMPPFCLGVGATAIGDFGSAAGELPVPVELAEACAHAVMKSGIDLAVSYCMQVDHGFAQP
LEFLLGGLDKVPVLPVFINGVATPLPGFQRTRMLGEAIGRFTSTLNKRVLFLGSGGLSHQ
PPVPELAKADAHMRDRLLGSGKDLPASERELRQQRVISAAEKFVEDQRTLHPLNPIWDNQ
FMTLLEQGRIQELDAVSNEELSAIAGKSTHEIKTWVAAFAAISAFGNWRSEGRYYRPIPE
WIAGFGSLSARTEN
              
                            

Download fasta file
RegulonDB