RegulonDB RegulonDB 11.0: Amino acid Sequence
acetaldehyde dehydrogenase (acetylating) MhpF Amino Acid Sequence


Size: 316

Fasta

 

>acetaldehyde dehydrogenase (acetylating) MhpF E. coli K12. Version NC_000913.3 GI:556503834
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
              
                            

Download fasta file
RegulonDB