RegulonDB RegulonDB 10.9: Amino acid Sequence
Holliday junction branch migration complex subunit RuvA Amino Acid Sequence


Size: 203

Fasta

 

>Holliday junction branch migration complex subunit RuvA E. coli K12. Version NC_000913.3 GI:556503834
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIREALRAAL
              
                            

Download fasta file
RegulonDB