RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF987 domain-containing protein YkfH Amino Acid Sequence


Size: 73

Fasta

 

>DUF987 domain-containing protein YkfH E. coli K12. Version NC_000913.3 GI:556503834
MKIISKRRAMTIYRQHPESRIFRYCTGKYQWHGSVCHYTGRDVPDIAGVLAVYAERRQDR
NGPYTCLMSITLN
              
                            

Download fasta file
RegulonDB