RegulonDB RegulonDB 10.9: Amino acid Sequence
DLP12 prophage; uncharacterized protein YlcG Amino Acid Sequence


Size: 46

Fasta

 

>DLP12 prophage; uncharacterized protein YlcG E. coli K12. Version NC_000913.3 GI:556503834
MMFEFNMAELLRHRWGRLRLYRFPGSVLTDYRILKNYAKTLTGAGV
              
                            

Download fasta file
RegulonDB