RegulonDB RegulonDB 10.8: Amino acid Sequence
DLP12 prophage; putative prophage lysis lipoprotein RzoD Amino Acid Sequence


Size: 60

Fasta

 

>DLP12 prophage; putative prophage lysis lipoprotein RzoD E. coli K12. Version NC_000913.3 GI:556503834
MRKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPRPPAWIMQPPPDWQTPLNGIISPSERG
              
                            

Download fasta file
RegulonDB