RegulonDB RegulonDB 10.9: Amino acid Sequence
enterobactin biosynthesis protein YbdZ Amino Acid Sequence


Size: 72

Fasta

 

>enterobactin biosynthesis protein YbdZ E. coli K12. Version NC_000913.3 GI:556503834
MAFSNPFDDPQGAFYILRNAQGQFSLWPQQCVLPAGWDIVCQPQSQASCQQWLEAHWRTL
TPTNFTQLQEAQ
              
                            

Download fasta file
RegulonDB