RegulonDB RegulonDB 10.10: Amino acid Sequence
PF04328 family protein YbdD Amino Acid Sequence


Size: 65

Fasta

 

>PF04328 family protein YbdD E. coli K12. Version NC_000913.3 GI:556503834
MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYEEFFRERQDARYGGKG
GARCC
              
                            

Download fasta file
RegulonDB