RegulonDB RegulonDB 10.10: Amino acid Sequence
stress-induced bacterial acidophilic repeat motifs-containing protein YmdF Amino Acid Sequence


Size: 57

Fasta

 

>stress-induced bacterial acidophilic repeat motifs-containing protein YmdF E. coli K12. Version NC_000913.3 GI:556503834
MANHRGGSGNFAEDRERASEAGKKGGQHSGGNFKNDPQRASEAGKKGGKSSHGKSDN
              
                            

Download fasta file
RegulonDB