RegulonDB RegulonDB 10.10: Amino acid Sequence
protein YcgI Amino Acid Sequence


Size: 113

Fasta

 

>protein YcgI E. coli K12. Version NC_000913.3 GI:556503834
MHLSNGMESKSVDTRSIYRELGATLSYNMRLGNGMEMNPG*RRLCAKNLSMITG*R*IMT
VISSMICRADVEYTRQLLKPHSAVRLADISGWGIAMVPVWNPRGTRWLV*TGR
              
                            

Download fasta file
RegulonDB