RegulonDB RegulonDB 10.8: Amino acid Sequence
Rac prophage; DUF1391 domain-containing protein YdaF Amino Acid Sequence


Size: 51

Fasta

 

>Rac prophage; DUF1391 domain-containing protein YdaF E. coli K12. Version NC_000913.3 GI:556503834
MQKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHTVS
              
                            

Download fasta file
RegulonDB