RegulonDB RegulonDB 10.9: Amino acid Sequence
Rac prophage; putative prophage outer membrane lipoprotein RzoR Amino Acid Sequence


Size: 61

Fasta

 

>Rac prophage; putative prophage outer membrane lipoprotein RzoR E. coli K12. Version NC_000913.3 GI:556503834
MRKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSGND
W
              
                            

Download fasta file
RegulonDB