RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF333 domain-containing protein YdbJ Amino Acid Sequence


Size: 88

Fasta

 

>DUF333 domain-containing protein YdbJ E. coli K12. Version NC_000913.3 GI:556503834
MRAAFWVGCAALLLSACSSEPVQQATAAHVAPGLKASMSSSGEANCAMIGGSLSVARQLD
GTAIGMCALPNGKRCSEQSLAAGSCGSY
              
                            

Download fasta file
RegulonDB